PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010819.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NF-YA
Protein Properties Length: 221aa    MW: 23974.9 Da    PI: 10.0312
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010819.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA108.17.1e-3482138158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQy++Il+RRq+Rak+e+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  Do010819.1  82 EEPIYVNAKQYHAILRRRQTRAKMEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 138
                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-3780141IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.72681141IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-2883138IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-2584106IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-25115138IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
LFLSSDNDSG HGKHNQETVN SVLSMGKQGS AFSPPKLGYN SSFVSFIYCD NCCFVKSCAL  60
VHPQQNHTTN APLMLPVEPA PEEPIYVNAK QYHAILRRRQ TRAKMEAQNK LVKGRKPYLH  120
ESRHRHAMKR ARGSGGRFLN TKQLCEQNQQ HQASGGSSCS KVIGNSISSQ GDPTPTPSAP  180
ASSDTASASR ANQDLTCFPS VGFRPAMNFS EQGGGGAKLV R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2482157274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122131RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0967382e-83FP096738.1 Phyllostachys edulis cDNA clone: bphylf045e19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958253.11e-119PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_004958254.11e-119PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_012698906.11e-119PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_012698907.11e-119PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
SwissprotQ93ZH24e-34NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLK3ZVX01e-119K3ZVX0_SETIT; Uncharacterized protein
STRINGSi030663m1e-118(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-35nuclear factor Y, subunit A3